PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG136500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 179aa    MW: 18690.8 Da    PI: 7.5017
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG136500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB181.19.3e-5731124194
                NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                          vreqdrflPian+srimkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplkvyl+ky
  Pavir.6KG136500.1.p  31 VREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKY 120
                          69**************************************************************************************** PP

                NF-YB  91 rele 94 
                          re +
  Pavir.6KG136500.1.p 121 REGD 124
                          *965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5330131IPR009072Histone-fold
SuperFamilySSF471133.11E-3934125IPR009072Histone-fold
PfamPF008082.3E-2837101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-226583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-2284102No hitNo description
PRINTSPR006151.2E-22103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MADAPASPGG GGGSHESGSP RGGAGGGGGG VREQDRFLPI ANISRIMKKA IPANGKIAKD  60
AKETVQECVS EFISFITSEA SDKCQREKRK TINGDDLLWA MATLGFEDYI EPLKVYLQKY  120
REGDSKLTAK TGDGSIKKDA LGHGGASSSA TQGMGQQGAY NQGMGYMQPQ YHNGDISN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-5030122193NF-YB
4awl_B3e-5030122294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-5030122294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.97100.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0410970.0BT041097.1 Zea mays full-length cDNA clone ZM_BFc0174L17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700237.11e-108PREDICTED: nuclear transcription factor Y subunit B
RefseqXP_004961815.11e-108PREDICTED: nuclear transcription factor Y subunit B
RefseqXP_004961814.11e-108PREDICTED: nuclear transcription factor Y subunit B
SwissprotP252091e-104NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLV5NZR81e-108V5NZR8_SORBI; Nuclear factor NF-YB2
STRINGSi023400m1e-107(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.14e-67nuclear factor Y, subunit B10